PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 327672
Common NameARALYDRAFT_327672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 80aa    MW: 9205.46 Da    PI: 5.7376
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
327672genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.25.1e-103474345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++eE++l  + +k+ G + W++Ia +++ gRt+ ++  +w 
           327672 34 NMSQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAGEIERFWM 74
                     689***************99.*********.**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.9E-83179IPR001005SANT/Myb domain
CDDcd001671.42E-63475No hitNo description
PfamPF002499.7E-93474IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-113574IPR009057Homeodomain-like
PROSITE profilePS500906.1563677IPR017877Myb-like domain
SuperFamilySSF466891.09E-73675IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010026Biological Processtrichome differentiation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MDNHRRTKQP KTNSIVTSSS EGTEVSSLEW EVVNMSQEEE DLVCRMHKLV GDRWELIAGR  60
IPGRTAGEIE RFWMMKIEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1180431e-115AK118043.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL19-27-F14.
GenBankBT0056111e-115BT005611.1 Arabidopsis thaliana clone U50786 putative myb family transcription factor (At4g01060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874998.12e-52myb family transcription factor
SwissprotQ9M1575e-37ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBLD7M4Z52e-52D7M4Z5_ARALL; Myb family transcription factor
STRINGfgenesh1_pm.C_scaffold_60028925e-52(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.11e-40CAPRICE-like MYB3